PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00003813.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family FAR1
Protein Properties Length: 651aa    MW: 75125.1 Da    PI: 9.1376
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00003813.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1232.6e-0732109988
                            FAR1   9 evGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnH 87 
                                     + G+ +++++sk+  + g  +  +  C + g+ ++e    e++++++++  ++C  k+  kk+ +g+w+v+ ++l HnH
  FANhyb_rscf00003813.1.g00001.1  32 MQGYMLVIKRSKSD-KYGAPKYVDIGCDRGGSYRTEVAL-ENRKKNSSSRLINCPFKILGKKTAEGVWKVEIISLSHNH 108
                                     56777888776655.7777999999********999988.888888899999*************************** PP

                            FAR1  88 e 88 
                                     e
  FANhyb_rscf00003813.1.g00001.1 109 E 109
                                     7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.1E-532109IPR004330FAR1 DNA binding domain
PfamPF105519.2E-31224319IPR018289MULE transposase domain
SuperFamilySSF577567.95E-6617643IPR001878Zinc finger, CCHC-type
Gene3DG3DSA:4.10.60.108.8E-4618640IPR001878Zinc finger, CCHC-type
PROSITE profilePS501589.34621638IPR001878Zinc finger, CCHC-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003676Molecular Functionnucleic acid binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 651 aa     Download sequence    Send to blast
MFDVSAEFLS LSTKVFETRE DLITDVRKIG SMQGYMLVIK RSKSDKYGAP KYVDIGCDRG  60
GSYRTEVALE NRKKNSSSRL INCPFKILGK KTAEGVWKVE IISLSHNHEP SIDMSGHPYC  120
RRFTQGEALQ VKQMSRAGIK PRQILSSLRQ TNPELLAVSR NVYSKTAQFR RESLDGRSVI  180
QALLDELGGA GFSHNVKYDH NGHLTHLFFA HPTSIQLTKN YSNVFVMDCT YKTNKYKMPL  240
LEIVGVSSFN TSFFSCFVFM QKEEQEDYEW ALQMFRNLLG YGNHPLVIIT DRELALMKAI  300
EVVFPMTPNL LCIWHIQKNI CAHCKGKFKE EADWVVFLSS WNTLLKSWNV STFNEAWNHF  360
QIEYKDYASV LTYIEDIWLP WKERFVYAWT GQTSHFGNNV TSRVEGAHAT IKRYLQVSTG  420
GLREVKENIC LAIENQFQEI RTQLASEKIR IPQKLCIPFF NETVNKVSFY ALYELQKQYT  480
LAHTKDYSSQ CKGHFFKTMG LPCVHMIKEM NIEVVPLNQI HMQWRIDTRT FTNDQHASLD  540
HEDSLCNLLS EIKEKYEKQP LMQKENTLRQ LSHILGASCP LLFEPTIQPH KGRPVGSTKR  600
KEPNSTKRDA SYFEIVDKTP RKCRGCGNTG HYRNKCPSIN KSAEPNVRNN V
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011462913.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_011462914.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLM5VQA30.0M5VQA3_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1327834
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G10240.12e-22FAR1-related sequence 11